PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0004100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 313aa    MW: 35137.3 Da    PI: 6.9342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0004100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.7e-124990748
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     eEd ll ++v q+G g+W +I+++ g++R++k+c++rw++yl
  Spipo17G0004100 49 EEDALLQRCVLQYGEGQWYLIPERAGLRRSRKSCRLRWLNYL 90
                     9***************************************97 PP

2Myb_DNA-binding45.12.4e-1496140147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E +l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo17G0004100  96 RGAFQEDEVDLIIRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 140
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.8544090IPR017930Myb domain
SMARTSM007174.2E-64292IPR001005SANT/Myb domain
SuperFamilySSF466891.13E-2249137IPR009057Homeodomain-like
CDDcd001674.76E-84990No hitNo description
Gene3DG3DSA:1.10.10.601.0E-174997IPR009057Homeodomain-like
PfamPF002493.9E-114990IPR001005SANT/Myb domain
PROSITE profilePS5129422.94991145IPR017930Myb domain
SMARTSM007179.6E-1195143IPR001005SANT/Myb domain
PfamPF002492.1E-1396140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2298144IPR009057Homeodomain-like
CDDcd001671.07E-9101138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MVDLGVGCVI AVVSLSCSLK RLPDLVGEKG GDFADVVRPQ PFKLKSLLEE DALLQRCVLQ  60
YGEGQWYLIP ERAGLRRSRK SCRLRWLNYL NPSIKRGAFQ EDEVDLIIRL HRLLGNRWSL  120
IAGRIPGRTA NDIKNYWNSC LCKKVGAQGK VAPKINKRNT VGLAAEPYDS CILGRATLSP  180
RLAHSPEAIL GCRHEIFSPR PRTMSDGPIC LPDIITCREP FPGGQCCSST DERLDNEQEV  240
MARTRLQLED DGKDQGHRQQ MEREDKDVIC FPVDEELRHW PPQTDDEVEG GLTGLDYRCL  300
GLTGLDYRLP DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-224914513108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FNV92e-46MY113_ARATH; Transcription factor MYB113
STRINGSolyc10g086250.1.12e-47(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-47myb domain protein 113